Compile Data Set for Download or QSAR
maximum 50k data
Found 3 Enz. Inhib. hit(s) with Target = 'Glucagon-like peptide 1 receptor' and Ligand = 'BDBM50273752'
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273752(CHEMBL503836 | HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR)
Affinity DataIC50:  2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273752(CHEMBL503836 | HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR)
Affinity DataIC50:  2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273752(CHEMBL503836 | HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR)
Affinity DataEC50:  0.00360nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed