Affinity DataKi: 0.00140nMAssay Description:Binding affinity to thrombin (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 0.00140nMAssay Description:Binding affinity to thrombin (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 0.00140nMAssay Description:Inhibition of thrombin (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 0.00150nMAssay Description:Inhibition of thrombin (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 0.00300nMAssay Description:Binding affinity to human erythrocytic ADA assessed as inhibition constant by spectrophotometric analysisMore data for this Ligand-Target Pair
Affinity DataKi: 0.0100nMAssay Description:Binding affinity to ADA (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
Affinity DataKi: <0.0100nMAssay Description:Binding affinity to thrombin (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: <0.0100nMAssay Description:Inhibition of thrombin (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: <0.0100nMAssay Description:Binding affinity to thrombin (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: <0.0100nMAssay Description:Inhibition of thrombin (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 0.0130nMAssay Description:Inhibition of human factor 10a using S-2765 as substrate after 30 mins by spectrophotometric methodMore data for this Ligand-Target Pair
Affinity DataKi: 0.0420nMAssay Description:Inhibition of thrombin (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 0.100nMAssay Description:Inhibition of human plasma kallikrein using H-D-Pro-Phe-Arg-p-nitroaniline as substrate assessed as inhibition constantMore data for this Ligand-Target Pair
Affinity DataKi: 0.100nMAssay Description:Inhibition of human plasma kallikrein using H-D-Pro-Phe-Arg-p-nitroaniline as substrate assessed as inhibition constantMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Hefei University Of Technology
Curated by ChEMBL
Hefei University Of Technology
Curated by ChEMBL
Affinity DataKi: 0.200nMAssay Description:Inhibition of JAK3 (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 0.270nMAssay Description:Binding affinity to Bacillus anthracis lethal factor assessed as inhibition constantMore data for this Ligand-Target Pair
Affinity DataKi: 0.300nMAssay Description:Compound was tested for binding affinity on intact HEK cells using [3H]diprenorphine as radioligand co-expressed with delta and kappa opioid receptor...More data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase kinase 4(Homo sapiens (Human))
Hefei University Of Technology
Curated by ChEMBL
Hefei University Of Technology
Curated by ChEMBL
Affinity DataKi: 0.400nMAssay Description:Inhibition of NIK (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 0.5nMAssay Description:Inhibition of human thrombin assessed as release of p-nitroanilide from chromogenic substrateMore data for this Ligand-Target Pair
Affinity DataKi: 0.5nMAssay Description:Compound was tested for binding affinity on intact HEK cells using [3H]diprenorphine as radioligand co-expressed with delta and kappa opioid receptor...More data for this Ligand-Target Pair
TargetDisintegrin and metalloproteinase domain-containing protein 17(Sus scrofa (pig))
Hefei University Of Technology
Curated by ChEMBL
Hefei University Of Technology
Curated by ChEMBL
Affinity DataKi: 0.560nMAssay Description:Inhibition of porcine TACEMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Hefei University Of Technology
Curated by ChEMBL
Hefei University Of Technology
Curated by ChEMBL
Affinity DataKi: 0.700nMAssay Description:Inhibition of JAK1 (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
TargetcGMP-specific 3',5'-cyclic phosphodiesterase(Homo sapiens (Human))
Shandong University
Curated by ChEMBL
Shandong University
Curated by ChEMBL
Affinity DataKi: 0.700nMAssay Description:Inhibition of PDE5 (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 0.800nMAssay Description:Inhibition of human thrombin assessed as release of p-nitroanilide from chromogenic substrateMore data for this Ligand-Target Pair
Affinity DataKi: 0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4(Homo sapiens (Human))
Hefei University Of Technology
Curated by ChEMBL
Hefei University Of Technology
Curated by ChEMBL
Affinity DataKi: 1nMAssay Description:Inhibition of CDK4 (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Hefei University Of Technology
Curated by ChEMBL
Hefei University Of Technology
Curated by ChEMBL
Affinity DataKi: 1nMAssay Description:Inhibition of JAK2 (unknown origin)More data for this Ligand-Target Pair
TargetRho-associated protein kinase 1(Homo sapiens (Human))
Hefei University Of Technology
Curated by ChEMBL
Hefei University Of Technology
Curated by ChEMBL
Affinity DataKi: 1nMAssay Description:Inhibition of ROCK1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Binding affinity to ADA (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
TargetRho-associated protein kinase 2(Homo sapiens (Human))
Hefei University Of Technology
Curated by ChEMBL
Hefei University Of Technology
Curated by ChEMBL
Affinity DataKi: 1nMAssay Description:Inhibition of ROCK2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 1.10nMAssay Description:Compound was tested for binding affinity on intact HEK cells using [3H]diprenorphine as radioligand singly expressed with delta or kappa receptorMore data for this Ligand-Target Pair
Affinity DataKi: 1.20nMAssay Description:Inhibition of human thrombin assessed as release of p-nitroanilide from chromogenic substrateMore data for this Ligand-Target Pair
Affinity DataKi: 1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Compound was tested for binding affinity on intact HEK cells using [3H]diprenorphine as radioligand co-expressed with delta and kappa opioid receptor...More data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
TargetcGMP-specific 3',5'-cyclic phosphodiesterase(Homo sapiens (Human))
Shandong University
Curated by ChEMBL
Shandong University
Curated by ChEMBL
Affinity DataKi: 1.60nMAssay Description:Inhibition of PDE5 (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 1.60nMAssay Description:Inhibition of human thrombin assessed as release of p-nitroanilide from chromogenic substrateMore data for this Ligand-Target Pair
TargetRho-associated protein kinase 2(Homo sapiens (Human))
Hefei University Of Technology
Curated by ChEMBL
Hefei University Of Technology
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of ROCK2 (unknown origin)More data for this Ligand-Target Pair
TargetRho-associated protein kinase 1(Homo sapiens (Human))
Hefei University Of Technology
Curated by ChEMBL
Hefei University Of Technology
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of ROCK1 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
Hefei University Of Technology
Curated by ChEMBL
Hefei University Of Technology
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of CDK1 (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 2.30nMAssay Description:Inhibition of thrombin (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 2.30nMAssay Description:Inhibition of thrombin (unknown origin)More data for this Ligand-Target Pair
TargetRho-associated protein kinase 2(Homo sapiens (Human))
Hefei University Of Technology
Curated by ChEMBL
Hefei University Of Technology
Curated by ChEMBL
Affinity DataKi: 2.40nMAssay Description:Inhibition of ROCK2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair