Affinity DataKi: 0.0130nMAssay Description:Inhibition of DHFR (unknown origin) at pH 6.7More data for this Ligand-Target Pair
Affinity DataKi: 0.560nMAssay Description:Binding affinity to human CB2 receptorMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.30nMAssay Description:Inhibition of thymidylate synthase (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
Affinity DataKi: 1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 3nMAssay Description:Displacement of [3H]-CP55,940 from human CB1 receptor expressed in HEK293 cellsMore data for this Ligand-Target Pair
Affinity DataKi: 3.20nMAssay Description:Binding affinity towards human poly(ADP-ribose) polymerase-1 (PARP-1)More data for this Ligand-Target Pair
Affinity DataKi: 3.80nMAssay Description:Inhibition of human Poly (ADP-ribose) polymerase 1 enzymeMore data for this Ligand-Target Pair
Affinity DataKi: 4.10nMAssay Description:Inhibitory activity of the compound against human full length Poly (ADP-ribose) polymerase 1More data for this Ligand-Target Pair
Affinity DataKi: 4.20nMAssay Description:Inhibitory activity of the compound against human full length Poly (ADP-ribose) polymerase 1More data for this Ligand-Target Pair
Affinity DataKi: 4.5nMAssay Description:Binding affinity towards human poly(ADP-ribose) polymerase-1 (PARP-1)More data for this Ligand-Target Pair
Affinity DataKi: 4.5nMAssay Description:Binding affinity towards human poly(ADP-ribose) polymerase-1 (PARP-1)More data for this Ligand-Target Pair
Affinity DataKi: 4.90nMAssay Description:Inhibitory activity of the compound against human full length Poly (ADP-ribose) polymerase 1More data for this Ligand-Target Pair
Affinity DataKi: 5nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
Affinity DataKi: 5nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
Affinity DataKi: 5nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
Affinity DataKi: 5nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
Affinity DataKi: 5.60nMAssay Description:Binding affinity towards human poly(ADP-ribose) polymerase-1 (PARP-1)More data for this Ligand-Target Pair
Affinity DataKi: 5.70nMAssay Description:Inhibitory activity of the compound against human full length Poly (ADP-ribose) polymerase 1More data for this Ligand-Target Pair
Affinity DataKi: 5.80nMAssay Description:Inhibitory activity of the compound against human full length Poly (ADP-ribose) polymerase 1More data for this Ligand-Target Pair
Affinity DataKi: 5.90nMAssay Description:Binding affinity towards human poly(ADP-ribose) polymerase-1 (PARP-1)More data for this Ligand-Target Pair
Affinity DataKi: 5.90nMAssay Description:Binding affinity towards human poly(ADP-ribose) polymerase-1 (PARP-1)More data for this Ligand-Target Pair
Affinity DataKi: 6nMAssay Description:Inhibition of human Poly (ADP-ribose) polymerase 1 enzymeMore data for this Ligand-Target Pair
Affinity DataKi: 6nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
Affinity DataKi: 6nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
Affinity DataKi: 6nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
Affinity DataKi: 6nMAssay Description:In vitro inhibitory activity of the compound towards human Poly (ADP-ribose) polymerase 1 (PARP-1)More data for this Ligand-Target Pair
Affinity DataKi: 6nMAssay Description:Inhibition of human Poly (ADP-ribose) polymerase 1 enzymeMore data for this Ligand-Target Pair
Affinity DataKi: 6.30nMAssay Description:Inhibitory activity of the compound against human full length Poly (ADP-ribose) polymerase 1More data for this Ligand-Target Pair
Affinity DataKi: 6.40nMAssay Description:Inhibition of human Poly (ADP-ribose) polymerase 1 enzymeMore data for this Ligand-Target Pair
Affinity DataKi: 6.80nMAssay Description:Inhibition of human Poly (ADP-ribose) polymerase 1 enzymeMore data for this Ligand-Target Pair
Affinity DataKi: 6.90nMAssay Description:Inhibition of human Poly (ADP-ribose) polymerase 1 enzymeMore data for this Ligand-Target Pair
Affinity DataKi: 7nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
Affinity DataKi: 7nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
Affinity DataKi: 7nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
Affinity DataKi: 7.20nMAssay Description:Binding affinity towards human poly(ADP-ribose) polymerase-1 (PARP-1)More data for this Ligand-Target Pair
Affinity DataKi: 7.20nMAssay Description:Inhibition of DHFR (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
Affinity DataKi: 7.5nMAssay Description:Inhibition of human Poly (ADP-ribose) polymerase 1 enzymeMore data for this Ligand-Target Pair
Affinity DataKi: 7.70nMAssay Description:Inhibitory activity of the compound against human full length Poly (ADP-ribose) polymerase 1More data for this Ligand-Target Pair
Affinity DataKi: 8nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
Affinity DataKi: 8nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
Affinity DataKi: 8nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair