Compile Data Set for Download or QSAR
maximum 50k data
Report error Found 201 of ki for UniProtKB: P50750
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM81441(CDK Inhibitor, 14)
Affinity DataKi:  0.400nMAssay Description:Inhibition of recombinant human His-tagged CDK9/cyclin T1 expressed in baculovirus infected sf9 cells using (biotinyl-Ahx-(Tyr-Ser-ProThr-Ser-Pro-Ser...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50553486(CHEMBL4782409)
Affinity DataKi:  1.70nMAssay Description:Inhibition of N-terminal His6-tagged thrombin cleavage site-fused human CDK9 (M1 to F372 residues)/cyclin-T1 (M1 to K726 residues) expressed in bacul...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431340(CHEMBL2348842)
Affinity DataKi:  2nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431363(CHEMBL46429)
Affinity DataKi:  2nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM81430(CDK Inhibitor, 3)
Affinity DataKi:  2nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50423753(CHEMBL601064)
Affinity DataKi:  2nMAssay Description:inhibition of CDK9/CyclinT1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431339(CHEMBL2348843)
Affinity DataKi:  3nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431337(CHEMBL2348845)
Affinity DataKi:  3nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431349(CHEMBL2348648)
Affinity DataKi:  3nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50443449(CHEMBL3087442)
Affinity DataKi:  3nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50443455(CHEMBL3087448)
Affinity DataKi:  3nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50423754(CHEMBL598992)
Affinity DataKi:  3nMAssay Description:inhibition of CDK9/CyclinT1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM5655(2-(2-chlorophenyl)-5,7-dihydroxy-8-[(3S,4R)-3-hydr...)
Affinity DataKi:  3nMAssay Description:Inhibition of CDK9/Cyclin T (1 to 330 amino acid residues) (unknown origin) by differential scanning fluorimetry assayMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50570310(CHEMBL4876861)
Affinity DataKi:  3nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM8061(2-Anilino-4-(thiazol-5-yl)pyrimidine deriv. 32 | 4...)
Affinity DataKi:  4nM ΔG°:  -11.6kcal/molepH: 7.2 T: 2°CAssay Description:In vitro kinase assay using purified enzyme, was incubated at 30 °C with substrate, and test compounds in the presence of 100 uM ATP/ [gamma-32P...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50570295(CHEMBL4854124)
Affinity DataKi:  4nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50229973((4-(2-Amino-4-methylthiazol-5-yl)pyrimidin-2-yl)-(...)
Affinity DataKi:  4nMAssay Description:Inhibition of CDK9/cyclin T1 (unknown origin) using (biotinyl-Ahx-(Tyr-Ser-ProThr-Ser-Pro-Ser)4-NH2 as substrate after 45 mins by [gamma-32P]ATP base...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431350(CHEMBL2348647)
Affinity DataKi:  4nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431348(CHEMBL2348649)
Affinity DataKi:  4nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431360(CHEMBL2347597)
Affinity DataKi:  4nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431338(CHEMBL2348844)
Affinity DataKi:  5nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431355(CHEMBL2348642)
Affinity DataKi:  5nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431358(CHEMBL2348638)
Affinity DataKi:  5nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50570317(CHEMBL4863915)
Affinity DataKi:  5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50443451(CHEMBL3087444)
Affinity DataKi:  5nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50570294(CHEMBL4855334)
Affinity DataKi:  5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431347(CHEMBL2348650)
Affinity DataKi:  5nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50570314(CHEMBL4847048)
Affinity DataKi:  6nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50570316(CHEMBL4864851)
Affinity DataKi:  6nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50425010(CHEMBL2312183)
Affinity DataKi:  6nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50425011(CHEMBL2312182)
Affinity DataKi:  6nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50425010(CHEMBL2312183)
Affinity DataKi:  6nMAssay Description:Inhibition of CDK9/Cyclin T (1 to 330 amino acid residues) (unknown origin) by differential scanning fluorimetry assayMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431353(CHEMBL2348644)
Affinity DataKi:  6nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50425011(CHEMBL2312182)
Affinity DataKi:  6nMAssay Description:Inhibition of CDK9/Cyclin T (1 to 330 amino acid residues) (unknown origin) by differential scanning fluorimetry assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431351(CHEMBL2348646)
Affinity DataKi:  7nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431356(CHEMBL2348641)
Affinity DataKi:  7nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50425009(CHEMBL2312184)
Affinity DataKi:  7nMAssay Description:Inhibition of CDK9/Cyclin T (1 to 330 amino acid residues) (unknown origin) by differential scanning fluorimetry assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataKi:  7nMAssay Description:Inhibition of CDK9/Cyclin T (1 to 330 amino acid residues) (unknown origin) by differential scanning fluorimetry assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431346(CHEMBL2348651)
Affinity DataKi:  7nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50570301(CHEMBL4868287)
Affinity DataKi:  7nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50443453(CHEMBL3087447)
Affinity DataKi:  7nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50425008(CHEMBL2312185)
Affinity DataKi:  7nMAssay Description:Inhibition of CDK9/Cyclin T (1 to 330 amino acid residues) (unknown origin) by differential scanning fluorimetry assayMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50570308(CHEMBL4863865)
Affinity DataKi:  7.5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50425006(CHEMBL2312187)
Affinity DataKi:  8nMAssay Description:Inhibition of CDK9/Cyclin T (1 to 330 amino acid residues) (unknown origin) by differential scanning fluorimetry assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50570302(CHEMBL4853628)
Affinity DataKi:  8nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50431335(CHEMBL2348847)
Affinity DataKi:  8nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50443457(CHEMBL3087433)
Affinity DataKi:  8nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50570299(CHEMBL4879020)
Affinity DataKi:  8nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50425007(CHEMBL2312186)
Affinity DataKi:  8nMAssay Description:Inhibition of CDK9/Cyclin T (1 to 330 amino acid residues) (unknown origin) by differential scanning fluorimetry assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nebraska Medical Center

Curated by ChEMBL
LigandPNGBDBM50570309(CHEMBL4868954)
Affinity DataKi:  8nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 201 total ) | Next | Last >>
Jump to: