Found 2 Enz. Inhib. hit(s) with Target = 'A disintegrin and metalloproteinase with thrombospondin motifs 5' and Ligand = 'BDBM50033807' TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 19nMAssay Description:Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 530nMAssay Description:Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay in presence of 50% rat plasmaMore data for this Ligand-Target Pair
