Compile Data Set for Download or QSAR
maximum 50k data
Found 205 Enz. Inhib. hit(s) with all data for entry = 50017511
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602423(CHEMBL5197758)
Affinity DataIC50:  2nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13)
Affinity DataIC50:  3nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM570070(US11427581, Compound 4-2)
Affinity DataIC50:  3nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602426(CHEMBL5191228)
Affinity DataIC50:  3nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602435(CHEMBL5200095 | US11919896, Compound 1-7)
Affinity DataIC50:  6nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM570070(US11427581, Compound 4-2)
Affinity DataIC50:  10nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM570068(US11427581, Compound 3-3)
Affinity DataIC50:  12nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602440(CHEMBL5201720 | US11919896, Compound 1-14)
Affinity DataIC50:  12nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50:  14nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602439(CHEMBL5172426 | US11919896, Compound 1-11)
Affinity DataIC50:  15nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM570069(US11427581, Compound 3-4)
Affinity DataIC50:  17nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602439(CHEMBL5172426 | US11919896, Compound 1-11)
Affinity DataIC50:  18nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602441(CHEMBL5192867 | US11919896, Compound 1-15)
Affinity DataIC50:  20nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM570060(US11427581, Compound 1-7)
Affinity DataIC50:  20nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602429(CHEMBL5198580 | US11919896, Compound 3-8)
Affinity DataIC50:  20nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602423(CHEMBL5197758)
Affinity DataIC50:  22nMAssay Description:Inhibition of recombinant human JAK2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM570070(US11427581, Compound 4-2)
Affinity DataIC50:  23nMAssay Description:Inhibition of recombinant human JAK2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602423(CHEMBL5197758)
Affinity DataIC50:  24nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602426(CHEMBL5191228)
Affinity DataIC50:  26nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602429(CHEMBL5198580 | US11919896, Compound 3-8)
Affinity DataIC50:  26nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50:  27nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM570071(US11427581, Compound 4-3)
Affinity DataIC50:  31nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602427(CHEMBL5206101)
Affinity DataIC50:  31nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602434(CHEMBL5180245 | US11919896, Compound 1-10)
Affinity DataIC50:  32nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM103727(US10112907, Example 00033 | US10206907, Compound 2...)
Affinity DataIC50:  33nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602438(CHEMBL5203588 | US11919896, Compound 1-9)
Affinity DataIC50:  34nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13)
Affinity DataIC50:  36nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13)
Affinity DataIC50:  37nMAssay Description:Inhibition of recombinant human JAK2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602435(CHEMBL5200095 | US11919896, Compound 1-7)
Affinity DataIC50:  38nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602426(CHEMBL5191228)
Affinity DataIC50:  40nMAssay Description:Inhibition of recombinant human JAK2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602436(CHEMBL5181588 | US11919896, Compound 1-12)
Affinity DataIC50:  45nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602422(CHEMBL5187505)
Affinity DataIC50:  48nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602430(CHEMBL5195430 | US11919896, Compound 3-9)
Affinity DataIC50:  54nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetNon-receptor tyrosine-protein kinase TYK2/Tyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13)
Affinity DataIC50:  60nMAssay Description:Inhibition of JAK1/TYK2 signalling in human whole blood assessed as inhibition of IFN-alpha stimulated STAT1 phosphorylation in CD4+ lymphocytes prei...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602435(CHEMBL5200095 | US11919896, Compound 1-7)
Affinity DataIC50:  60nMAssay Description:Inhibition of recombinant human JAK2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602418(CHEMBL5193147 | US11919896, Compound 6-7)
Affinity DataIC50:  63nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602420(CHEMBL5197776 | US11919896, Compound 7-7)
Affinity DataIC50:  63nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602443(CHEMBL5206970 | US11919896, Compound 1-17)
Affinity DataIC50:  65nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602427(CHEMBL5206101)
Affinity DataIC50:  67nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602431(CHEMBL5179073)
Affinity DataIC50:  68nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM570074(US11427581, Compound 6-1)
Affinity DataIC50:  70nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM570069(US11427581, Compound 3-4)
Affinity DataIC50:  71nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM570060(US11427581, Compound 1-7)
Affinity DataIC50:  73nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602428(CHEMBL5187733)
Affinity DataIC50:  75nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50:  78nMAssay Description:Inhibition of recombinant human JAK2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM570068(US11427581, Compound 3-3)
Affinity DataIC50:  78nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602429(CHEMBL5198580 | US11919896, Compound 3-8)
Affinity DataIC50:  80nMAssay Description:Inhibition of recombinant human JAK2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602417(CHEMBL5169563)
Affinity DataIC50:  90nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602441(CHEMBL5192867 | US11919896, Compound 1-15)
Affinity DataIC50:  106nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM103727(US10112907, Example 00033 | US10206907, Compound 2...)
Affinity DataIC50:  113nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In DepthDetails PubMed
Displayed 1 to 50 (of 205 total ) | Next | Last >>
Jump to: