Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-gated potassium channel subunit Kv7.2
LigandBDBM50143558
Substrate/Competitorn/a
Meas. Tech.ChEMBL_990142
EC50 1300±n/a nM
Citation Wu, YJConway, CMSun, LQMachet, FChen, JChen, PHe, HBourin, CCalandra, VPolino, JLDavis, CDHeman, KGribkoff, VKBoissard, CGKnox, RJThompson, MWFitzpatrick, WWeaver, DHarden, DGNatale, JDworetzky, SIStarrett, JE Discovery of (S,E)-3-(2-fluorophenyl)-N-(1-(3-(pyridin-3-yloxy)phenyl)ethyl)-acrylamide as a potent and efficacious KCNQ2 (Kv7.2) opener for the treatment of neuropathic pain. Bioorg Med Chem Lett23:6188-91 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Voltage-gated potassium channel subunit Kv7.2
Name:Voltage-gated potassium channel subunit Kv7.2
Synonyms:KQT-like 2 | Potassium channel subunit alpha KvLQT2 | Potassium voltage-gated channel subfamily KQT member 2
Type:PROTEIN
Mol. Mass.:84494.02
Organism:Mus musculus
Description:ChEMBL_990142
Residue:759
Sequence:
MVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSVLSKPRTG
GAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVFSCLVLSVFSTIKEYEK
SSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKFARKPFCVIDIMVLIASI
AVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYIGF
LCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLI
GVSFFALPAGILGSGFALKVQEQHRPKHFEKRRNPAAGLIQSAWRFYATNLSRTDLHSTW
QYYERTVTVPMYRLIPPLNQLELLRNLKSKSGLTFRKEPQPEPSPSQKVSLKDRVFSSPR
GMAAKGKGSPQAQTVRRSPSADQSLDDSPSKVPKSWSFGDRSRTRQAFRIKGAASRQNSE
EASLPGEDIVEDNKSCNCEFVTEDLTPGLKVSIRAVCVMRFLVSKRKFKESLRPYDVMDV
IEQYSAGHLDMLSRIKSLQSRIDMIVGPPPPSTPRDKKYPTKGPTAPSRESPQYSPRVDH
IVGRGPTITDKDRTKGPAETELPEDPSMMGRLGKVEKQVLSMEKKLDFLVSIYTQRMGIP
PAETEAYFGAKEPEPAPPYHSPEDSRDHADKHGCIIKIVRSTSSTGQRNYAAPPAIPPAQ
CPPSTSWQQSHQRHGTSPVGDHGSLVLRLERSAGMMSCH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50143558
NameBDBM50143558
Synonyms:CHEMBL41355 | EZOGABINE | N-(2-amino-4-(4-fluorobenzylamino)-phenyl)carbamic acid ethylester | RETIGABINE | [2-Amino-4-(4-fluoro-benzylamino)-phenyl]-carbamic acid ethyl ester
TypeSmall organic molecule
Emp. Form.C16H18FN3O2
Mol. Mass.303.3314
SMILESCCOC(=O)Nc1ccc(NCc2ccc(F)cc2)cc1N
Structure
n/a