BDBM50602437 CHEMBL5172397::US11919896, Compound 1-13

SMILES FC1(F)C[C@H]1C(=O)N1CC2(C1)CCC(CC2)c1cccc2nc(NC(=O)C3CC3)nn12

InChI Key InChIKey=ZOUHWHPRPDJDQE-UHFFFAOYSA-N

Data  19 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 23 hits for monomerid = 50602437   

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories Co.

US Patent
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
In Depth
Date in BDB:
1/6/2026
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories Co.

US Patent
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 3nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories Co.

US Patent
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 3nMAssay Description:JAK1:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2024
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories Co.

US Patent
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 36nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/6/2026
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories Co.

US Patent
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 36nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories Co.

US Patent
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 36nMAssay Description:TYK2:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2024
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories Co.

US Patent
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 37nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/6/2026
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories Co.

US Patent
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 37nMAssay Description:JAK2:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2024
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories Co.

US Patent
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 37nMAssay Description:Inhibition of recombinant human JAK2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 60nMAssay Description:Inhibition of JAK1/TYK2 signalling in human whole blood assessed as inhibition of IFN-alpha stimulated STAT1 phosphorylation in CD4+ lymphocytes prei...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 126nMAssay Description:Inhibition of JAK1/JAK2/TYK2 signalling in human whole blood assessed as inhibition of IL-6 stimulated STAT1 phosphorylation in CD4+ lymphocytes prei...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetJAK3/JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 157nMAssay Description:Inhibition of JAK1/JAK3 signalling in human whole blood assessed as inhibition of IL-2 stimulated STAT5 phosphorylation in CD4+ lymphocytes preincuba...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK3(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 1.52E+3nMAssay Description:Inhibition of recombinant human JAK3 using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK3(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 1.52E+3nMAssay Description:JAK3:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2024
Entry Details
US Patent

TargetTyrosine-protein kinase JAK3(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 1.52E+3nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/6/2026
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories Co.

US Patent
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 4.65E+3nMAssay Description:Inhibition of JAK2 signalling in human whole blood assessed as inhibition of GM-CSF stimulated STAT5 phosphorylation in CD33+ monocytes preincubated ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetCytochrome P450 2C19(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP2C19 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetCytochrome P450 2C8(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP2C8 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetCytochrome P450 1A2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP1A2 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetCytochrome P450 2D6(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP2D6 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetCytochrome P450 2C9(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP2C9 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetCytochrome P450 2B6(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP2B6 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetCytochrome P450 3A4(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602437BDBM50602437(CHEMBL5172397 | US11919896, Compound 1-13 | US1241...)
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP3A4 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed