Compile Data Set for Download or QSAR
Report error Found 180 Enz. Inhib. hit(s) with Target = 'Cyclin-A1/Cyclin-dependent kinase 2'
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270333BDBM50270333(CHEMBL4080236)
Affinity DataIC50: 1.10nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 2579BDBM2579(CHEMBL388978 | Staurosporine, 8 | Staurosporin, 4 ...)
Affinity DataIC50: 1.40nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 2579BDBM2579(CHEMBL388978 | Staurosporine, 8 | Staurosporin, 4 ...)
Affinity DataIC50: 1.5nMAssay Description:Inhibition of human CDK2/cyclin-A1 using [protein fragment, 39 aa] as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/27/2022
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270310BDBM50270310(CHEMBL4093906)
Affinity DataIC50: 1.60nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270329BDBM50270329(CHEMBL4073053)
Affinity DataIC50: 1.70nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 2579BDBM2579(CHEMBL388978 | Staurosporine, 8 | Staurosporin, 4 ...)
Affinity DataIC50: 1.80nMAssay Description:Inhibition of human CDK2/cyclin-A1 using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
2/19/2021
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270331BDBM50270331(CHEMBL4086149)
Affinity DataIC50: 1.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270319BDBM50270319(CHEMBL4093755)
Affinity DataIC50: 1.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270316BDBM50270316(CHEMBL4104057)
Affinity DataIC50: 2.10nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270358BDBM50270358(CHEMBL4076277)
Affinity DataIC50: 2.10nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270304BDBM50270304(CHEMBL4077071)
Affinity DataIC50: 2.5nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270309BDBM50270309(CHEMBL4101635)
Affinity DataIC50: 3nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50139171BDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50: 3nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/24/2022
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270353BDBM50270353(CHEMBL4075723)
Affinity DataIC50: 3.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270306BDBM50270306(CHEMBL4077074)
Affinity DataIC50: 3.40nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270359BDBM50270359(CHEMBL4096307)
Affinity DataIC50: 3.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270308BDBM50270308(CHEMBL4074948)
Affinity DataIC50: 4.5nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270330BDBM50270330(CHEMBL4078261)
Affinity DataIC50: 4.5nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270335BDBM50270335(CHEMBL4088753)
Affinity DataIC50: 5.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270317BDBM50270317(CHEMBL4067804)
Affinity DataIC50: 5.70nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270298BDBM50270298(CHEMBL4075720)
Affinity DataIC50: 5.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270342BDBM50270342(CHEMBL4103390)
Affinity DataIC50: 7.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270354BDBM50270354(CHEMBL4073283)
Affinity DataIC50: 7.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270318BDBM50270318(CHEMBL4071450)
Affinity DataIC50: 8.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270303BDBM50270303(CHEMBL4061686)
Affinity DataIC50: 9.30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270334BDBM50270334(CHEMBL4099013)
Affinity DataIC50: 9.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50539903BDBM50539903(CHEMBL4641226)
Affinity DataIC50: 11nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK2/cyclinA1 expressed in baculovirus infected Sf9 insect cells using FRET-labeled...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/12/2021
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50539902BDBM50539902(CHEMBL4644893)
Affinity DataIC50: 11nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK2/cyclinA1 expressed in baculovirus infected Sf9 insect cells using FRET-labeled...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/12/2021
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270332BDBM50270332(CHEMBL4077278)
Affinity DataIC50: 12nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270307BDBM50270307(CHEMBL4092761)
Affinity DataIC50: 14nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50539906BDBM50539906(CHEMBL4648005 | US11142507, Compound MFH-3-35-1)
Affinity DataIC50: 16nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK2/cyclinA1 expressed in baculovirus infected Sf9 insect cells using FRET-labeled...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/12/2021
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50576561BDBM50576561(CHEMBL4876559)
Affinity DataIC50: 17nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/24/2022
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270305BDBM50270305(CHEMBL4103338)
Affinity DataIC50: 17nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50576543BDBM50576543(CHEMBL4870754)
Affinity DataIC50: 20nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/24/2022
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 5931BDBM5931(cid_3025986 | CHEMBL296468 | N-(5-{[(5-tert-butyl-...)
Affinity DataIC50: 21nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK2/cyclinA1 expressed in baculovirus infected Sf9 insect cells using FRET-labeled...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/12/2021
Entry Details Article
PubMedPDB3D3D Structure (crystal)
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50563174BDBM50563174(CHEMBL1708376)
Affinity DataIC50: 24nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270356BDBM50270356(CHEMBL4064843)
Affinity DataIC50: 24nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270337BDBM50270337(CHEMBL4075466)
Affinity DataIC50: 30nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50576545BDBM50576545(CHEMBL4866768)
Affinity DataIC50: 31nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/24/2022
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50576558BDBM50576558(CHEMBL4873799)
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/24/2022
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50515042BDBM50515042(CHEMBL4593398)
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/24/2022
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50576556BDBM50576556(CHEMBL4856733)
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/24/2022
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50576541BDBM50576541(CHEMBL4869193)
Affinity DataIC50: 40nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/24/2022
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50563177BDBM50563177(CHEMBL4763182)
Affinity DataIC50: 46nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50576552BDBM50576552(CHEMBL4869214)
Affinity DataIC50: 46nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/24/2022
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50576559BDBM50576559(CHEMBL4864901)
Affinity DataIC50: 49nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/24/2022
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270360BDBM50270360(CHEMBL4098796)
Affinity DataIC50: 57nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50576560BDBM50576560(CHEMBL4867152)
Affinity DataIC50: 58nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/24/2022
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50539901BDBM50539901(CHEMBL4643057)
Affinity DataIC50: 59nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK2/cyclinA1 expressed in baculovirus infected Sf9 insect cells using FRET-labeled...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/12/2021
Entry Details Article
PubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50270336BDBM50270336(CHEMBL4059849)
Affinity DataIC50: 59nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2020
Entry Details Article
PubMed
Displayed 1 to 50 (of 180 total ) | Next | Last >>
Jump to: