Compile Data Set for Download or QSAR
Report error Found 58 Enz. Inhib. hit(s) with Target = 'Ephrin type-A receptor 7'
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50628739BDBM50628739(CHEMBL5423601)
Affinity DataIC50: 1.80nMAssay Description:Inhibition of EphA7 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/19/2024
Entry Details
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50345579BDBM50345579(5-((5-(4-((4-(2-hydroxyethyl)piperazin-1-yl)methyl...)
Affinity DataIC50: 4.20nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] peptide substrate by Hotspot assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/5/2011
Entry Details Article
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 4.60nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and measured after 120...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 2579BDBM2579(CHEMBL388978 | Staurosporine, 8 | Staurosporin, 4 ...)
Affinity DataIC50: 39.2nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/27/2022
Entry Details Article
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 21BDBM21(VANDETANIB | N-(4-bromo-2-fluorophenyl)-6-methoxy-...)
Affinity DataKd:  50nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 2579BDBM2579(CHEMBL388978 | Staurosporine, 8 | Staurosporin, 4 ...)
Affinity DataIC50: 56.3nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
2/19/2021
Entry Details Article
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 185674BDBM185674(Rebastinib | 4-[4-[(5-tert-butyl-2-quinolin-6-ylpy...)
Affinity DataIC50: 88nMAssay Description:Inhibition of human wild type EPHA7 using PolyEY as substrate preincubated for 2 hrs followed by ATP addition and measured every 2 mins for 2.5 hrs b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 21079BDBM21079(1-[4-(3-azanyl-1H-indazol-4-yl)phenyl]-3-(2-fluora...)
Affinity DataKd:  110nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 378885BDBM378885(US10266537, Compound 93)
Affinity DataIC50: 143nMAssay Description:Inhibition of human recombinant EPHA7 (613 to 909 residues) using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC incubated for 40 mins in presence of [gamma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50605159BDBM50605159(CHEMBL5195469)
Affinity DataIC50: 162nMAssay Description:Inhibition of human wild type partial length EphA7 (Y608 to S912 residues) expressed in bacterial expression system by Kinomescan methodMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/25/2023
Entry Details
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50466038BDBM50466038(CHEMBL4281823)
Affinity DataIC50: 190nMAssay Description:Inhibition of recombinant human EphA7 (613 to 909 residues) using KTFCGTPEYLAPE as substrate after 40 mins in presence of [gamma-33P]-ATP by scintill...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/18/2020
Entry Details Article
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50563891BDBM50563891(CHEMBL4793380)
Affinity DataIC50: 199nMAssay Description:Inhibition of recombinant human EphA7 (613 to 909 residues) using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in prese...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/29/2022
Entry Details Article
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50368452BDBM50368452(CHEMBL4168305)
Affinity DataKd:  200nMAssay Description:Binding affinity to human EPHA7More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2020
Entry Details Article
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 4779BDBM4779(cid_156414 | PD0183805 | CHEMBL545315 | CHEMBL3196...)
Affinity DataKd:  270nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 31096BDBM31096(CHEMBL290084 | Staurosporine | cid_451705 | US2024...)
Affinity DataKd:  290nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 21079BDBM21079(1-[4-(3-azanyl-1H-indazol-4-yl)phenyl]-3-(2-fluora...)
Affinity DataKd:  330nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 16673BDBM16673(BAY439006 | CHEMBL1336 | BAY 43-9006 | 4-[4-({[4-c...)
Affinity DataKd:  370nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 31085BDBM31085(cid_11409972 | 1-[4-[(4-ethylpiperazin-1-yl)methyl...)
Affinity DataKd:  380nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 5446BDBM5446(Erlotinib | OSI-774 | N-(3-ethynylphenyl)-6,7-bis(...)
Affinity DataKd:  440nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 24773BDBM24773(N-(3,3-dimethyl-2,3-dihydro-1H-indol-6-yl)-2-[(pyr...)
Affinity DataKd:  490nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 31093BDBM31093(cid_11712649 | 4-[[7-[2,6-bis(fluoranyl)phenyl]-9-...)
Affinity DataKd:  580nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 5447BDBM5447(ZD1839 | N-(3-chloro-4-fluorophenyl)-7-methoxy-6-[...)
Affinity DataKd:  590nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 31096BDBM31096(CHEMBL290084 | Staurosporine | cid_451705 | US2024...)
Affinity DataKd:  630nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50271212BDBM50271212(CHEMBL3715238)
Affinity DataIC50: 665nMAssay Description:Inhibition of recombinant GST-tagged human EphA7 cytoplasmic domain expressed in baculovirus expression system by FRET assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
4/23/2020
Entry Details Article
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50505541BDBM50505541(CHEMBL4465866)
Affinity DataKd:  766nMAssay Description:Binding affinity to recombinant N-terminal His-FLAG-GST-tagged EPHA7 (unknown origin) ( 595 to 998 residues) expressed in baculovirus infected Sf9 in...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/18/2021
Entry Details Article
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 13533BDBM13533(1-[5-tert-butyl-2-(p-tolyl)pyrazol-3-yl]-3-[4-(2-m...)
Affinity DataKd:  860nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50505542BDBM50505542(CHEMBL4576489)
Affinity DataKd:  887nMAssay Description:Binding affinity to recombinant N-terminal His-FLAG-GST-tagged EPHA7 (unknown origin) ( 595 to 998 residues) expressed in baculovirus infected Sf9 in...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/18/2021
Entry Details Article
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 4814BDBM4814(SUNITINIB MALATE | CHEMBL535 | N-[2-(diethylamino)...)
Affinity DataKd:  960nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50244430BDBM50244430(AP24149 | CHEMBL488840 | 9-(2,6-dimethylstyryl)-N-...)
Affinity DataIC50: 1.00E+3nMAssay Description:Inhibition of EphA1More data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 13533BDBM13533(1-[5-tert-butyl-2-(p-tolyl)pyrazol-3-yl]-3-[4-(2-m...)
Affinity DataIC50: 1.00E+3nMAssay Description:Inhibition of human EPHA7More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/11/2021
Entry Details Article
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50185140BDBM50185140(AP-26113 | Brigatinib | US11248003, Example Brigat...)
Affinity DataIC50: 1.00E+3nMAssay Description:Inhibition of human EPHA7 using poly (Glu, Tyr)4:1 as substrate in presence of [gamma33P]-ATP by HotSpot assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 31093BDBM31093(cid_11712649 | 4-[[7-[2,6-bis(fluoranyl)phenyl]-9-...)
Affinity DataKd:  1.00E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 31085BDBM31085(cid_11409972 | 1-[4-[(4-ethylpiperazin-1-yl)methyl...)
Affinity DataKd:  1.10E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50299218BDBM50299218(Cpd66 | 8-(2-Methoxyphenyl)-1-methyl-7-(2'-methyl-...)
Affinity DataIC50: 1.12E+3nMAssay Description:Inhibition of EphA7 by [gamma33-P]ATP based assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/29/2010
Entry Details Article
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50652793BDBM50652793(CHEMBL5653589)
Affinity DataKd:  1.18E+3nMAssay Description:Binding affinity to human EPHA7 incubated for 45 mins by Kinobead based pull down assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 13336BDBM13336(4-{4-(4-fluorophenyl)-2-[4-(methylsulfinyl)phenyl]...)
Affinity DataKd:  1.20E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 5446BDBM5446(Erlotinib | OSI-774 | N-(3-ethynylphenyl)-6,7-bis(...)
Affinity DataKd:  1.40E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 31088BDBM31088(1-methyl-5-[[2-[5-(trifluoromethyl)-1H-imidazol-2-...)
Affinity DataKd:  1.50E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 31095BDBM31095(5-[(Z)-(5-fluoranyl-2-oxidanylidene-1H-indol-3-yli...)
Affinity DataKd:  2.00E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 13533BDBM13533(1-[5-tert-butyl-2-(p-tolyl)pyrazol-3-yl]-3-[4-(2-m...)
Affinity DataKd:  2.00E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 13531BDBM13531(4-[4-(4-Fluorophenyl)-5-(4-pyridinyl)-1H-imidazol-...)
Affinity DataKd:  2.20E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 21BDBM21(VANDETANIB | N-(4-bromo-2-fluorophenyl)-6-methoxy-...)
Affinity DataKd:  2.40E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 4814BDBM4814(SUNITINIB MALATE | CHEMBL535 | N-[2-(diethylamino)...)
Affinity DataKd:  2.40E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 6866BDBM6866(1-Acyl-1H-[1,2,4]triazole-3,5-diamine Analogue 3b ...)
Affinity DataKd:  3.10E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50551644BDBM50551644(CHEMBL4745937)
Affinity DataEC50:  3.26E+3nMAssay Description:Inhibition of human EPHA7 incubated for 30 mins by Kinobead based assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/24/2022
Entry Details Article
PubMed
TargetEphrin type-A receptor 7(Mouse)
Universita di Parma

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50649172BDBM50649172(CHEMBL3735992)
Affinity DataIC50: 4.50E+3nMAssay Description:Displacement of biotinylated Fc-tagged ephrin-A1 from recombinant N/C-terminal 6-his tagged mouse EphA7 (Ala30 to Pro549 residues) preincubated for 1...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
10/12/2025
Entry Details
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50299148BDBM50299148(1-{4-[(3-cyclopropyl-1H-pyrazol-5-yl)amino]pyrrolo...)
Affinity DataKd:  5.00E+3nMAssay Description:Binding affinity to EPHA7 (unknown origin) by phage based competition assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 16673BDBM16673(BAY439006 | CHEMBL1336 | BAY 43-9006 | 4-[4-({[4-c...)
Affinity DataKd:  5.30E+3nMpH: 7.4 T: 2°CAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/14/2009
Entry Details
PCBioAssay
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50519662BDBM50519662(CHEMBL4438748)
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of recombinant human EphA7 (613 to 909 residues) using KTFCGTPEYLAPE as substrate measured after 40 mins in presence of [gamma33ATP] by ra...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/23/2021
Entry Details Article
PubMed
TargetEphrin type-A receptor 7(Human)
Jinan University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50135286BDBM50135286(CHEMBL3745885)
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/27/2017
Entry Details Article
PubMed
Displayed 1 to 50 (of 58 total ) | Next | Last >>
Jump to: